PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g013903m
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family GRAS
Protein Properties Length: 435aa    MW: 47657.3 Da    PI: 4.9742
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g013903mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS360.23e-110794313374
               GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfs 94 
                         lLl+cAe+v+ ++l  a+ lL ++sel+sp  ++ +R+ ayf+ AL+ar+++s+ ++y+ l++++ + ++s++ ++al+ ++ ++P++kfs
  orange1.1g013903m  79 GLLLQCAECVAMDNLDDATDLLPEISELSSPFVSSPERVGAYFAHALQARVVSSCLGTYSPLTTKSLTLSQSQKIFNALQSYNSICPLIKFS 170
                        58****************************************************************************************** PP

               GRAS  95 hltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrl 186
                        h+taNqaI +a++g+++vHiiD+di+qGlQWp L++ L sR+++  s+RiTg+gs             erLa+fA +lg+pf+fn+l  k  
  orange1.1g013903m 171 HFTANQAIFQALDGADCVHIIDLDIMQGLQWPGLFHILVSRSKKIRSMRITGFGS-----------SSERLADFAMSLGLPFDFNPLEGKIG 251
                        *******************************************************...........469*****************999999 PP

               GRAS 187 edleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpre 278
                        + +++++L v+pgE+++V++++  h l+d ++s       +L+++  l+Pk++++veq+++h ++sFl rf+eal+yysalfd+l  +l+++
  orange1.1g013903m 252 NIIDVSQLGVRPGETIVVHWMH--HCLYDITGSDLG----TLRMLTLLRPKLITIVEQDLSH-GGSFLGRFVEALHYYSALFDALGDGLGAD 336
                        999*****************99..777777777777....**********************.789************************** PP

               GRAS 279 seerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsv 370
                        s er++vE++l+g ei+n+va  g +r+ + + +e+W e l+++GF+pv+ls + a+qa+lll +++++gy++ ee+g+l lgWkd +L+++
  orange1.1g013903m 337 SIERHTVEQQLFGCEIRNIVAVGGPKRTGEVK-VERWGEELKRVGFRPVSLSGNPAAQASLLLGMFPWKGYTLVEENGCLKLGWKDLSLLTA 427
                        **************************998887.9********************************************************** PP

               GRAS 371 SaWr 374
                        SaW+
  orange1.1g013903m 428 SAWQ 431
                        ***6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098549.31851411IPR005202Transcription factor GRAS
PfamPF035141.0E-10779431IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048366Biological Processleaf development
GO:0090610Biological Processbundle sheath cell fate specification
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 435 aa     Download sequence    Send to blast
MLQSLVVPQS PINSSTAMKS KRVDRDDDDD NPNGDPSRAV AKRANVIEQE QKLQEQEEEA  60
EQHDVVVMEG ESAGLRLLGL LLQCAECVAM DNLDDATDLL PEISELSSPF VSSPERVGAY  120
FAHALQARVV SSCLGTYSPL TTKSLTLSQS QKIFNALQSY NSICPLIKFS HFTANQAIFQ  180
ALDGADCVHI IDLDIMQGLQ WPGLFHILVS RSKKIRSMRI TGFGSSSERL ADFAMSLGLP  240
FDFNPLEGKI GNIIDVSQLG VRPGETIVVH WMHHCLYDIT GSDLGTLRML TLLRPKLITI  300
VEQDLSHGGS FLGRFVEALH YYSALFDALG DGLGADSIER HTVEQQLFGC EIRNIVAVGG  360
PKRTGEVKVE RWGEELKRVG FRPVSLSGNP AAQASLLLGM FPWKGYTLVE ENGCLKLGWK  420
DLSLLTASAW QPSD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A6e-47774314375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006429765.10.0hypothetical protein CICLE_v10011732mg
RefseqXP_006481359.10.0PREDICTED: scarecrow-like protein 23
SwissprotQ9FHZ10.0SCL23_ARATH; Scarecrow-like protein 23
TrEMBLV4SVF60.0V4SVF6_9R
STRINGGLYMA11G10220.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM125122631
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G41920.10.0GRAS family protein